Fukutin anticorps (N-Term)

N° du produit ABIN630326

L’anticorps Lapin Polyclonal anti-Fukutin a été validé pour WB et IHC. Il convient pour détecter Fukutin dans des échantillons de Humain, Rat et Chien.

Aperçu rapide pour Fukutin anticorps (N-Term) (ABIN630326)

Antigène: Fukutin (FKTN)

Reactivité: Humain, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fukutin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Fukutin anticorps

Épitope: N-Term

Specificité: FKTN antibody was raised against the N terminal Of Fktn

Purification: Purified

Immunogène: FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKTN Blocking Peptide, (ABIN5613600), is also available for use as a blocking control in assays to test for specificity of this FKTN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fukutin

Antigène: Fukutin (FKTN)

Autre désignation: FKTN

Sujet: FKTN regulates the migration and assembly of neurons during cortical histogenesis. Fukuyama congenital muscular dystrophy results from mutations in its gene.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process